SELK_MOUSE Q9JLJ1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JLJ1
Recommended name：Selenoprotein K
EC number：
Alternative names：(SelK)
Cleaved into：
GeneID：80795
Gene names (primary )：Selenok
Gene names (synonym )：Selk
Gene names (ORF )：
Length：94
Mass：10642
Sequence：MVYISNGQVLDSRNQSPWRVSFLTDFFWGIAEFVVFFFKTLLQQDVKKRRGYGSSSDSRYDDGRGPPGNPPRRMGRISHLRGPSPPPMAGGUGR
Tissue specificity：High expression in spleen and intestine (at protein level). Expressed in a range of immune cells including T and B-cells and also in myeloid cells including macrophages, neutrophils and dendritic cells (at protein level). {ECO:0000269|PubMed:21220695, ECO:0000269|PubMed:21849499}.
Induction：By increased dietary selenium. Expression is significantly decreased by a low selenium diet. {ECO:0000269|PubMed:21220695}.
Developmental stage：
Protein families：Selenoprotein K family