OSTA_MOUSE Q8R000
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R000
Recommended name：Organic solute transporter subunit alpha
EC number：
Alternative names：(OST-alpha) (Solute carrier family 51 subunit alpha)
Cleaved into：
GeneID：106407
Gene names (primary )：Slc51a
Gene names (synonym )：Osta
Gene names (ORF )：
Length：340
Mass：37759
Sequence：MEPGRTHIKLDPRYTAELLELLETNYSISPACFSHPPTAAQLLRALGPVDIALTIILTFLTTGSVAIFLEDAVYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAITSFYAVCFYLLMMVMVEGFGGKKAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLLLLGPFQYAFFKITLSIVGLFLIPDGIYDPGEISEKSAALWINNLLAVSTLLALWSLAILFRQAKMHLGEQNMGSKFALFQVLVILTALQPAIFSILANSGQIACSPPYSSKIRSQVMNCHMLILETFLMTVLTRMYYRRKDDKVGYEACSLPDLDSALKA
Tissue specificity：Present at high levels in ileum. In ileum, it is restricted to the apical domain on the mature villus enterocytes with little detectable expression in the goblet cells or crypt enterocytes (at protein level). Expressed in kidney but not in heart, brain, liver, spleen, embryo, lung, thymus, ovary nor testis. {ECO:0000269|PubMed:15563450, ECO:0000269|PubMed:16317684}.
Induction：Positively regulated via the bile acid-activated nuclear receptor farnesoid X receptor (NR1H4/FXR). Up-regulated in mice lacking Mrp4, but it is unable to compensate for the absence of Mrp4. {ECO:0000269|PubMed:16357058, ECO:0000269|PubMed:16628672}.
Developmental stage：
Protein families：OST-alpha family