CCL1_MOUSE   P10146


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P10146

Recommended name:C-C motif chemokine 1

EC number:

Alternative names:(P500) (SIS-epsilon) (Small-inducible cytokine A1) (T-cell activation protein 3) (TCA-3) (TCA3)

Cleaved into:

GeneID:20290

Gene names  (primary ):Ccl1

Gene names  (synonym ):Scya1 Tca3

Gene names  (ORF ):

Length:92

Mass:10276

Sequence:MKPTAMALMCLLLAAVWIQDVDSKSMLTVSNSCCLNTLKKELPLKFIQCYRKMGSSCPDPPAVVFRLNKGRESCASTNKTWVQNHLKKVNPC

Tissue specificity:

Induction:Produced by T-cell after stimulation by antigen or induction by concanavalin a (Con-A).

Developmental stage:

Protein families:Intercrine beta (chemokine CC) family


   💬 WhatsApp