LPAR1_MOUSE P61793
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61793
Recommended name：Lysophosphatidic acid receptor 1
EC number：
Alternative names：(LPA receptor 1) (LPA-1) (Lysophosphatidic acid receptor Edg-2) (Rec1.3) (VZG-1)
Cleaved into：
GeneID：14745
Gene names (primary )：Lpar1
Gene names (synonym )：Edg2 Gpcr26 Lpa1 Vzg1
Gene names (ORF )：
Length：364
Mass：41119
Sequence：MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVCVFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSNDHSVV
Tissue specificity：Detected in lung (PubMed:21821728). Detected in oligodendrocytes in corpus callosum in brain cortex (at protein level) (PubMed:25226845). Expressed within the embryonic cerebral cortex, where it is enriched in the ventricular zone (PubMed:8922387). In the adult brain, also expressed in oligodendrocytes, as well as Schwann cells of the peripheral nervous system (PubMed:9013780, PubMed:25226845). Expressed in many other tissues, including lung, heart, intestine, spleen, thymus, and stomach. No expression in liver (PubMed:9013780). Detected in kidney and testis (PubMed:9013780, PubMed:12215548). Detected in embryonic fibroblasts (PubMed:12215548). Detected in adult lung fibroblasts and lung endothelial cells (PubMed:18066075). Detected in dorsal root ganglion and dorsal root (PubMed:15195086). Detected in astrocytes (PubMed:17692995). Detected in bone (PubMed:21569876). {ECO:0000269|PubMed:12215548, ECO:0000269|PubMed:15195086, ECO:0000269|PubMed:18066075, ECO:0000269|PubMed:21569876, ECO:0000269|PubMed:25226845, ECO:0000269|PubMed:8922387, ECO:0000269|PubMed:9013780}.
Induction：Up-regulated by bacterial lipopolysaccharide (LPS) (at protein level). Up-regulated by bacterial lipopolysaccharide (LPS). {ECO:0000269|PubMed:21821728}.
Developmental stage：
Protein families：G-protein coupled receptor 1 family