CLIC4_MOUSE Q9QYB1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QYB1
Recommended name：Chloride intracellular channel protein 4
EC number：
Alternative names：(mc3s5/mtCLIC)
Cleaved into：
GeneID：29876
Gene names (primary )：Clic4
Gene names (synonym )：
Gene names (ORF )：
Length：253
Mass：28729
Sequence：MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Tissue specificity：Detected in blood vessels in the retina (at protein level). Expressed to the greatest extent in vivo in heart, lung, liver, kidney, and skin. {ECO:0000269|PubMed:10593946, ECO:0000269|PubMed:17636002, ECO:0000269|PubMed:19197003}.
Induction：Up-regulated by calcium ions in differentiating keratinocytes. {ECO:0000269|PubMed:17636002}.
Developmental stage：
Protein families：Chloride channel CLIC family