TAFA4_MOUSE Q7TPG5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TPG5
Recommended name：Chemokine-like protein TAFA-4
EC number：
Alternative names：
Cleaved into：
GeneID：320701
Gene names (primary )：Tafa4
Gene names (synonym )：Fam19a4
Gene names (ORF )：
Length：135
Mass：15018
Sequence：MRVCAKWVLLSRWLVLTYVLMVCCKLMSASSQHLRGHAGHHLIKPGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEAAIVIEKWWCHMNPCLEGEDCKVLPDSSGWSCSSGNKVKTTKVTR
Tissue specificity：Expressed in a descrete subset of dorsal root ganglia neurons called C-low-threshold mechanoreceptors (at protein level) (PubMed:24139797). Expressed in LPS-stimulated monocytes and macrophages, especially in polarized M1 (PubMed:25109685). {ECO:0000269|PubMed:24139797, ECO:0000269|PubMed:25109685}.
Induction：Up-regulated in LPS-stimulated monocytes and macrophages, especially in polarized M1. {ECO:0000269|PubMed:25109685}.
Developmental stage：
Protein families：TAFA family