NEDD8_MOUSE   P29595


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P29595

Recommended name:NEDD8

EC number:

Alternative names:(Neddylin) (Neural precursor cell expressed developmentally down-regulated protein 8) (NEDD-8) (Ubiquitin-like protein Nedd8)

Cleaved into:

GeneID:18002

Gene names  (primary ):Nedd8

Gene names  (synonym ):Nedd-8

Gene names  (ORF ):

Length:81

Mass:8972

Sequence:MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLGQ

Tissue specificity:Ubiquitously expressed (at protein level). {ECO:0000269|PubMed:15183309, ECO:0000269|PubMed:8395831}.

Induction:

Developmental stage:According to PubMed:1378265 and PubMed:15183309, down-regulated during embryonic development, but according to PubMed:10597293, expression does not change during embryonic development. Between 10 dpc and 12 dpc, expressed in heart and spinal ganglia. Between 13.5 dpc and 16.5 dpc, strongly expressed in spinal and sympathetic ganglia, neural epithelium of the retina, oral and olfactory epithelia and thymus. {ECO:0000269|PubMed:10597293, ECO:0000269|PubMed:12215427, ECO:0000269|PubMed:15183309, ECO:0000269|PubMed:9353319}.

Protein families:Ubiquitin family


   💬 WhatsApp