WNT1_MOUSE   P04426


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P04426

Recommended name:Proto-oncogene Wnt-1

EC number:

Alternative names:(Proto-oncogene Int-1)

Cleaved into:

GeneID:22408

Gene names  (primary ):Wnt1

Gene names  (synonym ):Int-1 Wnt-1

Gene names  (ORF ):

Length:370

Mass:41086

Sequence:MGLWALLPSWVSTTLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Tissue specificity:Testis and mid-gestational embryos. In the testis, detected only in postmeiotic germ cells undergoing differentiation from round spermatids into mature spermatozoa. In the embryos, expression is restricted to the developing CNS in regions of the neural tube other than the telencephalon. Expressed in osteoblast; expression levels increase with advancing osteoblast differentiation. Expressed in the brain, femur, spleen, and hematopoietic bone marrow. {ECO:0000269|PubMed:23499309, ECO:0000269|PubMed:23656646, ECO:0000269|PubMed:3594566}.

Induction:

Developmental stage:Accumulates throughout the neural plate at the anterior head folds of the 9 day embryo but only at its lateral tips in more posterior regions. Following neural tube closure, expression is restricted to specific regions of the dorsal wall of the brain ventricles and spinal cord, the ventral wall of the midbrain and the diencephalon, and the lateral walls of the neuroepithelium at the midbrain-hindbrain junction. {ECO:0000269|PubMed:3594565}.

Protein families:Wnt family


   💬 WhatsApp