RCOR1_MOUSE Q8CFE3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CFE3
Recommended name：REST corepressor 1
EC number：
Alternative names：(Protein CoREST)
Cleaved into：
GeneID：217864
Gene names (primary )：Rcor1
Gene names (synonym )：D12Wsu95e Kiaa0071
Gene names (ORF )：
Length：480
Mass：52715
Sequence：MPAMVEKGPEVSGKRRGRNTAASAASAAASAASAAASAAASAGTASASAAAAASAAAAPNNGQNKSLAAAAPNGNSGSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAAVPDFDPAKLARRSQERDNLGMLVWSPNQSLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEETNGSNPVDIEIDPNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSIKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKDETNGPANQKPVKSPESSIKIPEEEDEAASVLDVRYASAS
Tissue specificity：Expressed in the external germinal layer (EGL) and internal granular layer (IGL) of the cerebellum and in Purkinje cells (at protein level). {ECO:0000269|PubMed:20346398}.
Induction：Down-regulated by the transcriptional repressor ZEB1 during NEUROD2-induced neurogenesis. {ECO:0000269|PubMed:20346398}.
Developmental stage：At embryonic day 8.5, it is highly expressed in the head mesenchyme, but neither in the somites nor in the presomitic mesoderm. By day 11.5 it is expressed fairly ubiquitously throughout the embryo. {ECO:0000269|PubMed:10734093}.
Protein families：CoREST family