PTTG1_MOUSE Q9CQJ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQJ7
Recommended name：Securin
EC number：
Alternative names：(Pituitary tumor-transforming gene 1 protein)
Cleaved into：
GeneID：30939
Gene names (primary )：Pttg1
Gene names (synonym )：Pttg
Gene names (ORF )：
Length：199
Mass：21725
Sequence：MATLIFVDKDNEEPGRRLASKDGLKLGTGVKALDGKLQVSTPRVGKVFNAPAVPKASRKALGTVNRVAEKPMKTGKPLQPKQPTLTGKKITEKSTKTQSSVPAPDDAYPEIEKFFPFNPLDFESFDLPEEHQISLLPLNGVPLMTLNEERGLEKLLHLGPPSPLKTPFLSWESDPLYSPPSALSTLDVELPPVCYDADI
Tissue specificity：
Induction：
Developmental stage：During the stages 11.5-13.5 dpc it is expressed in most tissues of the embryo. Within the telencephalon, it is exclusively expressed inside of the ventricular zone (VZ). The expression reaches its peak by 15.5 dpc and starts to decrease by 18.5 dpc, and is not detectable in the adult brains. Most of the cells expressing it were found in the lower part of the ventricular zone. {ECO:0000269|PubMed:10727870}.
Protein families：Securin family