NKX31_MOUSE   P97436


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97436

Recommended name:Homeobox protein Nkx-3.1

EC number:

Alternative names:(Homeobox protein NK-3 homolog A)

Cleaved into:

GeneID:18095

Gene names  (primary ):Nkx3-1

Gene names  (synonym ):Nkx-3.1 Nkx3a

Gene names  (ORF ):

Length:237

Mass:26824

Sequence:MLRVAEPREPRVEAGGRSPWAAPPTQSKRLTSFLIQDILRDRAERHGGHSGNPQHSPDPRRDSAPEPDKAGGRGVAPEDPPSIRHSPAETPTEPESDAHFETYLLDCEHNPGDLASAPQVTKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSEDLGVLEKNSPLSLPALKDDSLPSTSLVSVYTSYPYYPYLYCLGSWHPSFW

Tissue specificity:Expressed mostly in the male urogenital tract, with highest expression in the epithelial cells lining the ducts of anterior, dorsolateral and ventral prostate and in the bulbourethral gland, and much lower in the seminal vesicle and the testis. Expression in the prostate increases during sexual maturation and is drastically reduced following castration. Expressed also in brain (hippocampus and external granular layer of the cerebral cortex), kidney (intralobular arteries), thymus and adrenal and salivary glands.

Induction:By androgens. During embryonic development, induced and maintained by sonic hedgehog in pre-somitic mesoderm, in immature somites and in urogenital sinus, but not in the other expression domains.

Developmental stage:Early marker of the sclerotome and of a subset of vascular smooth muscle cells, expressed also in outgrowths of epithelial cells, in ectodermal epithelial cells and in restricted regions of the central nervous system. Detected first at 7.5 dpc in the paraxial mesoderm adjacent to the neural fold. At 8.5 dpc, segmental expression in the first 8 or 9 somites. Expression proceeds caudally in parallel with somite maturation and is restricted to the sclerotome. As the somites mature, expression moves away from the axial structures, becomes transiently restricted to a subset of early myotomal cells at the dorsal medial lip and is subsequently down-regulated. At 10.5 dpc, expressed only in the most caudal immature somites. At 9.5 dpc, present in the dorsal aorta. At 11.5 dpc, restricted to the vascular smooth muscle cells of caudal region of the dorsal aorta. At 12.5 dpc, expressed in the distal epithelium of the tongue and in Rathke pouch (anterior pituitary). By 13.5 dpc, also detected in tooth buds. Expression in the abdominal aorta continues through 11.5 to 15.5 dpc. Detected in the vertebral vessels at 12.5 dpc, in the carotid vessel at 13.5 dpc and in arcuate and interlobular arteries of the kidney at 15.5 dpc. In neonates, present in palatine glands, epithelial root sheath of the tooth and epithelial hair sheath. In the nervous system of neonates, expressed in the olfactory lobe, olfactory epithelial cells and cerebellar cortex. Expressed in the male urogenital system during late embryogenesis: at day 14.5, expressed in the outbuddings of the pelvic region of the urogenital sinus, and, at lower levels, in the prospective urethra. Expression is confined to the epithelial cells that are invaginating into the surrounding mesenchyme, with highest levels at the leading edge. At 17.5 dpc, present in the developing ventral, dorsolateral and anterior prostatic buds, in the nascent bulbourethral glands, as well as in the epithelial ducts that join the glands to the prospective urethra. During postnatal growth and morphogenesis of the prostate, high expression is maintain at sites of ductal outgrowth and branching. In the developing testis, detected at 14.5 and 17.5 dpc in the medullary cords, which form seminiferous tubules.

Protein families:NK-3 homeobox family


   💬 WhatsApp