CXE1_MOUSE Q9CX92
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CX92
Recommended name：Gap junction epsilon-1 protein
EC number：
Alternative names：(Connexin-23) (Cx23)
Cleaved into：
GeneID：76743
Gene names (primary )：Gje1
Gene names (synonym )：Cx23 Gjf1
Gene names (ORF )：
Length：205
Mass：23831
Sequence：MSLNYIKNFYEGCVKPPTVIGQFHTLFFGSVRMFFLGVLGFAVYGNEALHFSCDPDKREINLFCYNQFRPITPQVFWALQLVIVLLPGAIFHLYAACKSINQDCILQKPVYTVIYVLSVLLRISLEVFAFWLQIHLFGFQVKPIYLCDTESLGKKPNILKCMVPEHFEKTIFLIAMYTFTVITMVLCVAEVFEIIFRRSCFLFKR
Tissue specificity：Highly expressed in lens, where it is mainly found in lens fibers and to a lesser extent in lens epithelium (PubMed:18385072, PubMed:18849090). Weakly expressed in retina (PubMed:18849090). Not detected in other tissues tested (PubMed:18385072, PubMed:18849090). {ECO:0000269|PubMed:18385072, ECO:0000269|PubMed:18849090}.
Induction：
Developmental stage：Expressed at the posterior region of the lens vesicle at embryonic stage 11.5 dpc. Detected at the tip of elongating lens fiber cells at stage 12.5 dpc. Expressed in lens epithelial cells, and weakly in retina, at stage 15.5 dpc. {ECO:0000269|PubMed:18385072}.
Protein families：Connexin family, Beta-type (group I) subfamily