HXD12_MOUSE P23812
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23812
Recommended name：Homeobox protein Hox-D12
EC number：
Alternative names：(Homeobox protein Hox-4.7) (Homeobox protein Hox-5.6)
Cleaved into：
GeneID：15432
Gene names (primary )：Hoxd12
Gene names (synonym )：Hox-4.7 Hoxd-12
Gene names (ORF )：
Length：268
Mass：29198
Sequence：MCERSLYRAGYVGSLLNLQSPDSFYFSNLRANGSQLAALPPISYPRSALPWATTPASCTPAQPATASAFGGFSQPYLTGSGPIGLQSPGAKDGPEDQVKFYTPDAPTASEERSRTRPPFAPESSLVHSALKGTKYDYAGVGRTAPGSATLLQGAPCASSFKEDTKGPLNLNMAVQVAGVASCLRSSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVQREQALALY
Tissue specificity：
Induction：
Developmental stage：Expressed during development of the posterior part of the body.
Protein families：Abd-B homeobox family