PHF10_MOUSE Q9D8M7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D8M7
Recommended name：PHD finger protein 10
EC number：
Alternative names：(BRG1-associated factor 45a) (BAF45a)
Cleaved into：
GeneID：72057
Gene names (primary )：Phf10
Gene names (synonym )：Baf45a
Gene names (ORF )：
Length：497
Mass：55840
Sequence：MTAAGPGAAPSPGRCDSDPASPGAQSPKDDNEDNSNDGTHPCKRRRMGSGDSSRSCETSSQDLSFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQSTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTDRTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGGGDEKRKNKGTSDSSSGNVSEGDSPPDSQEDTFHGRQKSKDKMATPRKDGSKRSVLSKSAPGYKPKVIPNALCGICLKGKESNKKGKAESLIHCSQCDNSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDVCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG
Tissue specificity：Widely expressed. Expressed selectively in neural stem and progenitor cells (at protein level). {ECO:0000269|PubMed:17640523}.
Induction：
Developmental stage：Expressed in neural cells at 10.5-11.5 dpc. At 10.5 to 16.5 dpc, in the developing spinal cord, specifically expressed in proliferating neural progenitors of the ventricular zone. In the developing forebrain and cerebellar primordium, expression is restricted to proliferating neuroepithelial progenitors and cerebellar granule precursors. {ECO:0000269|PubMed:17640523}.
Protein families：SAYP family