OOSP1_MOUSE Q925U0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q925U0
Recommended name：Oocyte-secreted protein 1
EC number：
Alternative names：(Initiate factor 3)
Cleaved into：
GeneID：170834
Gene names (primary )：Oosp1
Gene names (synonym )：If3
Gene names (ORF )：
Length：202
Mass：23013
Sequence：MKPFVGLLGLLLLLSFMKTCADDWTAISLQCADHWFHLRIRPTIFHNIFMEPDEVFLGIGCPVTTTWPNDTYEFIYRTYSCGIANKVLCDVTLLKTQLTYISKNASLQAEMSLSCVMHNQSPHFCEAESRGDFTGDPPGWTEDMRARRDEQTVPMVQPNLSTSSEDHHVSTEPWASETSRSEAAEVPSFMDQNFSVFHFSRM
Tissue specificity：Expressed in oocytes in primary through antral-stage follicles. Expressed in liver and ovary. {ECO:0000269|PubMed:11747200, ECO:0000269|PubMed:12237121}.
Induction：
Developmental stage：Expressed in preimplantation embryo. Expressed in liver at 16 dpc but not at 13 dpc. {ECO:0000269|PubMed:12237121}.
Protein families：PLAC1 family