HELT_MOUSE Q7TS99
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TS99
Recommended name：Hairy and enhancer of split-related protein HELT
EC number：
Alternative names：(HES/HEY-like transcription factor) (Protein Hes-like) (Protein megane)
Cleaved into：
GeneID：234219
Gene names (primary )：Helt
Gene names (synonym )：Hesl Mgn
Gene names (ORF )：
Length：240
Mass：26973
Sequence：MSDRLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADFPRGREKELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPTFPPLSLPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALPYLSSATVPLPSPAQQHSPFLAPMQGLDRHYLNLIGHGHPNGLNLHTPQHPPVL
Tissue specificity：Expressed in heart and testis.
Induction：
Developmental stage：Expressed in the progenitor domains for mesencephalic GABAergic neurons. {ECO:0000269|PubMed:15071116, ECO:0000269|PubMed:16644143, ECO:0000269|PubMed:16968817, ECO:0000269|PubMed:17611227}.
Protein families：HEY family