FIBP_MOUSE Q9JI19
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JI19
Recommended name：Acidic fibroblast growth factor intracellular-binding protein
EC number：
Alternative names：(aFGF intracellular-binding protein) (FGF-1 intracellular-binding protein)
Cleaved into：
GeneID：58249
Gene names (primary )：Fibp
Gene names (synonym )：
Gene names (ORF )：
Length：357
Mass：41204
Sequence：MTSELDIFVGNTTLIDEDVYRLWLDGYSVNDAVALRVRSGILEQTGATTGVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQTLLIERYYTFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQVDDMDVDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMETNFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRLFLSQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
Tissue specificity：
Induction：
Developmental stage：Expressed throughout the development in embryo at 10.5 dpc. Expressed in the central nervous system at 12.5 dpc. Expressed in the ventral part of caudal diencephalon at 12.5 dpc. Expressed in the dorsal root ganglia at 12.5 dpc. Expressed in the kidney and lung at 12.5 dpc. Expressed in the dorsal and ventral midbrain at 18.5 dpc. Expressed uniformely in the cortex at 18.5 dpc. {ECO:0000269|PubMed:27183861}.
Protein families：