CAVN4_MOUSE   A2AMM0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2AMM0

Recommended name:Caveolae-associated protein 4

EC number:

Alternative names:(Muscle-related coiled-coil protein) (Muscle-restricted coiled-coil protein)

Cleaved into:

GeneID:68016

Gene names  (primary ):Cavin4

Gene names  (synonym ):Murc

Gene names  (ORF ):

Length:362

Mass:41008

Sequence:MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVASVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDIPCPASLSVVKDRSLPENQEEAEEVFDPPIELSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSRENMQKTRQTLDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISSAAPSKEAFKIRSLRKAKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDEFSETEKEVTKGGYSPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS

Tissue specificity:Abundantly expressed in cardiac and skeletal muscle (at protein level). Weaker expression in aorta and lung. In heart, expressed in cardiomyocytes and vascular smooth muscle cells but not in other surrounding cells including vascular endothelial cells. {ECO:0000269|PubMed:18332105, ECO:0000269|PubMed:19546242}.

Induction:Up-regulated in response to cardiac hypertrophy. {ECO:0000269|PubMed:18332105}.

Developmental stage:Expression increases during development from embryo to adult. {ECO:0000269|PubMed:18332105}.

Protein families:CAVIN family


   💬 WhatsApp