FOXO1_MOUSE Q9R1E0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R1E0
Recommended name：Forkhead box protein O1
EC number：
Alternative names：(Forkhead box protein O1A) (Forkhead in rhabdomyosarcoma)
Cleaved into：
GeneID：56458
Gene names (primary )：Foxo1
Gene names (synonym )：Fkhr Foxo1a
Gene names (ORF )：
Length：652
Mass：69518
Sequence：MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
Tissue specificity：Expressed in liver, white and brown adipose tissues (at protein level). {ECO:0000269|PubMed:17627282, ECO:0000269|PubMed:22510882}.
Induction：Expression is regulated by KRIT1 (PubMed:20668652). Transiently up-regulated during adipogenesis (at protein level) (PubMed:18388859). {ECO:0000269|PubMed:18388859, ECO:0000269|PubMed:20668652}.
Developmental stage：In liver, barely expressed at 14.5 dpc, expression dramatically increases at 18.5 dpc. Abundantly expressed in neonate liver but levels strongly decrease in adult liver (at protein level). {ECO:0000269|PubMed:17627282}.
Protein families：