REG3G_MOUSE O09049
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O09049
Recommended name：Regenerating islet-derived protein 3-gamma
EC number：
Alternative names：(REG-3-gamma) (Pancreatitis-associated protein 3) (Regenerating islet-derived protein III-gamma) (Reg III-gamma)
Cleaved into：Regenerating islet-derived protein 3-gamma 16.5 kDa form; Regenerating islet-derived protein 3-gamma 15 kDa form
GeneID：19695
Gene names (primary )：Reg3g
Gene names (synonym )：Pap3
Gene names (ORF )：
Length：174
Mass：19307
Sequence：MLPRITITIMSWMLLSCLMLLSQVQGEVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
Tissue specificity：Predominantly expressed in the small intestine, including Paneth cells (at protein level). Hardly detectable in the colon (at protein level). Highly expressed in the lung epithelium during methicillin-resistant S.aureus infection (at protein level). Skin injury increases its epidermal expression. Also expressed in the pancreas. {ECO:0000269|PubMed:16504538, ECO:0000269|PubMed:16931762, ECO:0000269|PubMed:17635956, ECO:0000269|PubMed:21998396, ECO:0000269|PubMed:22727489, ECO:0000269|PubMed:23401489, ECO:0000269|PubMed:9055810}.
Induction：Up-regulated in Paneth cells by intestinal microbiota (at protein level). MyD88-mediated signals are essential for its induction in intestinal epithelial cells. Induction in the lung is dependent on IL6ST-induced STAT3 signaling. IL17A induces its expression in primary keratinocytes and skin wounds. {ECO:0000269|PubMed:16931762, ECO:0000269|PubMed:17635956, ECO:0000269|PubMed:22727489, ECO:0000269|PubMed:23401489}.
Developmental stage：In mid-small intestine, very low levels at birth. Expression levels rise dramatically during the weaning period (P17-P22) and remain high into adulthood in conventionally raised but not germfree animals. {ECO:0000269|PubMed:16931762}.
Protein families：