EFNA5_MOUSE O08543
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08543
Recommended name:Ephrin-A5
EC number:
Alternative names:(AL-1) (EPH-related receptor tyrosine kinase ligand 7) (LERK-7)
Cleaved into:
GeneID:13640
Gene names (primary ):Efna5
Gene names (synonym ):Epl7 Eplg7 Lerk7
Gene names (ORF ):
Length:228
Mass:26339
Sequence:MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
Tissue specificity:Expressed in myogenic progenitor cells. {ECO:0000269|PubMed:27446912}.
Induction:
Developmental stage:In myogenic progenitor cells, highly expressed at 11.5 dpc and ceases its expression at the late fetal stage (17.5 dpc). {ECO:0000269|PubMed:27446912}.
Protein families:Ephrin family