DTX2_MOUSE Q8R3P2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R3P2
Recommended name：Probable E3 ubiquitin-protein ligase DTX2
EC number：EC 2.3.2.27
Alternative names：(Protein deltex-2) (Deltex2) (mDTX2) (RING-type E3 ubiquitin transferase DTX2)
Cleaved into：
GeneID：74198
Gene names (primary )：Dtx2
Gene names (synonym )：
Gene names (ORF )：
Length：619
Mass：67195
Sequence：MAMAPSSSLPQVYPSHVVVAVWEWQDGLGIWHPYSATVCSFIEQHFVRQRGQHFGLGSLAHSIPLGQADPSLAPYIIDLPSWTQFRQNTGTMRSVRRHLFSQNSAPGQGIVWEWLGDDGSWVAYEARICDYLEQQVARGIQVVDLAPLGYNYTVNYATLTQTNKTSSFCRSVRRQVGPVYPVTSDIAVPRQMGLICFCQQCLHGSGTGPVSGRYRHSMTNLPAYPAPQAPHRTTTVSGAHQAFAPYNKPSLSGARSAPRLNTTNPWAAAPPVAGNQSLFHSSLSHLGPQLLPSGPSTSSGASASFPSGPSSSSPGSAPTTVPVQMPKASRVQQALAGMTSVLSAIGLPVCLSRAPRPTGPPASRPASKSHSSVKRLRKMSVKEGAPKPEPEQVIRKYTEELKVAPEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPWGKMEVFRFQMSLPGHEDCGTILIVYNIPHGIQGPEHPSPGKPFTARGFPRQCYLPDSPQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNVTGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ
Tissue specificity：Expressed in testis and the CNS. {ECO:0000269|PubMed:11226752}.
Induction：
Developmental stage：In the CNS, it is expressed in the developing neural tube starting from 10.5 dpc in the spinal cord and around 11.5 dpc in the telencephalon. Expressed ubiquitously throughout the spinal cord and telencephalon during neurogenesis. Expressed throughout the developing retina at 15.5 dpc. Not expressed in the somite or presomite during somitogenesis. Expressed slightly earlier that Dtx1 and Dtx3. {ECO:0000269|PubMed:11226752}.
Protein families：Deltex family