RPC7_MOUSE Q6NXY9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6NXY9
Recommended name：DNA-directed RNA polymerase III subunit RPC7
EC number：
Alternative names：(RNA polymerase III subunit C7) (DNA-directed RNA polymerase III subunit G)
Cleaved into：
GeneID：67486
Gene names (primary )：Polr3g
Gene names (synonym )：
Gene names (ORF )：
Length：223
Mass：25947
Sequence：MAGNKGRGRAAYTFNIEAVGFSRGEKLPDVVLKPPPLFPDTDYKPVPLKTGEDEDYMLALKQELRETVKRLPYFIEPPEEKQDDIERYSKRYMKVYKEEWVPDWRRLPREMMPRKKCKKGDPKSKPSKAAAKATSLINSADVLKTIEELEKRGEGERSDEENEEKEGSKEKDKDDEEDGEEDAEQEDYDEEEQEEENDYINSYFDNGDDFGVDSDDNMDEATY
Tissue specificity：Expressed at low levels in the liver. {ECO:0000269|PubMed:24107381}.
Induction：
Developmental stage：Not detectable in unfertilized oocytes. First detected in zygotes and the 2-cell stage embryos. Expressed until at least the early blastocyst stage. {ECO:0000269|PubMed:21898682}.
Protein families：Eukaryotic RPC7 RNA polymerase subunit family