HAX1_MOUSE   O35387


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35387

Recommended name:HCLS1-associated protein X-1

EC number:

Alternative names:(HS1-associating protein X-1) (HAX-1) (HS1-binding protein 1) (HSP1BP-1)

Cleaved into:

GeneID:23897

Gene names  (primary ):Hax1

Gene names  (synonym ):Hs1bp1

Gene names  (ORF ):

Length:280

Mass:31654

Sequence:MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDDDDDDEAEEDRGAWGRESYAFDGSQPPEEFGFSFSPRGGMRFHGNFGFDDLVRDFNSIFSEMGAWTLPSHSPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFEGVLESHAKPESPKPAPDWGSQGPFHRLDDTWPVSPHSRAKEDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEERRTVVDSEGRRETTVTHQEAHDSSRSDPDSQRSSALDDPFSILDLLLGRWFRSR

Tissue specificity:Ubiquitous, with highest levels in kidney and liver (at protein level). {ECO:0000269|PubMed:16814492}.

Induction:

Developmental stage:

Protein families:HAX1 family