LPXN_MOUSE   Q99N69


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99N69

Recommended name:Leupaxin

EC number:

Alternative names:

Cleaved into:

GeneID:107321

Gene names  (primary ):Lpxn

Gene names  (synonym ):

Gene names  (ORF ):

Length:386

Mass:43478

Sequence:MEELDALLEELERCTFQDSEEYSNPVSCHLDQQSTEESKIPQTPKTLSSQGNTSPLKVQLVYATNIQEPNVYSEVQEPKESVLPPKTSAAAQLDELMAHLSEMQAKVSVKADTSRKPLPDQQDHKASLDSMLGDLEQELQDLGIATVPKGYCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEELGSSPFFERSGLAYCSKDYHRLFSPRCAYCAAPITDKVLTAMNKTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMNTVWHPECFVCGDCFSSFSSGSFFELDGRPFCELHYHHRRGTLCHDCGQPITGRCISAMGHKFHPEHFVCAFCLTQLPKGIFKEQNNKTYCEKCFTKLFSQ

Tissue specificity:Expressed in osteoclasts (at protein level). Highly expressed in vascular smooth muscle. {ECO:0000269|PubMed:12674328, ECO:0000269|PubMed:18497331}.

Induction:

Developmental stage:

Protein families:Paxillin family