GDIR2_MOUSE   Q61599


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61599

Recommended name:Rho GDP-dissociation inhibitor 2

EC number:

Alternative names:(Rho GDI 2) (D4) (Rho-GDI beta)

Cleaved into:

GeneID:11857

Gene names  (primary ):Arhgdib

Gene names  (synonym ):Gdid4

Gene names  (ORF ):

Length:200

Mass:22851

Sequence:MTEKDAQPQLEEADDDLDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVADPTVPNVTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDWTE

Tissue specificity:Preferentially expressed in hematopoietic cells. {ECO:0000269|PubMed:7512369}.

Induction:

Developmental stage:

Protein families:Rho GDI family