SPOP_MOUSE Q6ZWS8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6ZWS8
Recommended name：Speckle-type POZ protein
EC number：
Alternative names：(HIB homolog 1) (PDX-1 C-terminal-interacting factor 1)
Cleaved into：
GeneID：20747
Gene names (primary )：Spop
Gene names (synonym )：Pcif1
Gene names (ORF )：
Length：374
Mass：42132
Sequence：MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Tissue specificity：Widely expressed, mainly in pancreas and in particular in adult pancreatic insulin-producing beta cells and in a subset of exocrine acinar and duct cells.
Induction：
Developmental stage：
Protein families：Tdpoz family