HGFA_MOUSE Q9R098
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R098
Recommended name：Hepatocyte growth factor activator
EC number：EC 3.4.21.-
Alternative names：(HGF activator) (HGFA)
Cleaved into：Hepatocyte growth factor activator short chain; Hepatocyte growth factor activator long chain
GeneID：54426
Gene names (primary )：Hgfac
Gene names (synonym )：
Gene names (ORF )：
Length：653
Mass：70568
Sequence：MGRQAWISSLCPLPRPCPFLLLLLLLVVPRGAQPQAGRNHTEPPGPNVTATPVTPTIPVISGNVSTSTESAPAAETEGPQSERYPPPSSSSPPGGQVLTESGQPCRFPFRYGGRMLHSCTSEGSAYRKWCATTHNYDRDRAWGYCAEVTLPVEGPAILDPCASGPCLNGGTCSSTHDHGSYHCSCPLAFTGKDCGTEKCFDETRYEYFEVGDHWARVSEGHVEQCGCMEGQARCEDTHHTACLSSPCLNGGTCHLIVGTGTSVCTCPLGYAGRFCNIVPTEHCFLGNGTEYRGVASTAASGLSCLAWNSDLLYQELHVDSVAAAVLLGLGPHAYCRNPDKDERPWCYVVKDNALSWEYCRLTACESLARVHSQTPEILAALPESAPAVRPTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGNSFCAGSLVHTCWVVSAAHCFANSPPRDSITVVLGQHFFNRTTDVTQTFGIEKYVPYTLYSVFNPNNHDLVLIRLKKKGERCAVRSQFVQPICLPEAGSSFPTGHKCQIAGWGHMDENVSSYSNSLLEALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLYGIISWGDGCGRLNKPGVYTRVANYVDWINDRIRPPKRPVATS
Tissue specificity：
Induction：
Developmental stage：
Protein families：Peptidase S1 family