S35G2_RAT Q5M7A3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5M7A3
Recommended name：Solute carrier family 35 member G2
EC number：
Alternative names：
Cleaved into：
GeneID：315957
Gene names (primary )：Slc35g2
Gene names (synonym )：Tmem22
Gene names (ORF )：
Length：412
Mass：46,596
Sequence：MDTSPSKKYPIKKRVKIHPNTVMVKYTSHYPQPGEDGYEEINEDYGRFMEENPKKSLLSEMRRKGRTLFGTMDTQPPRSEDPRASSRGQFQSFAEKNIFQSRKMWLVLFGSALAHGCVALITRLVSDRSKVPSLELIFIRSVLQVLSVIVVCYYQEAPFGPSGYRLRLFLYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAVLAFLLVDEKMAYVDMATVVCSILGVCLVMIPNIADEDNSLLNVWKEAFGYTMTVMAGLTTALSMIVYRSIREKISMWTALFTFGWTGTIWGLSTMFVLQEPIIPLDGETWSYLIAICICSTVAFLGVYYALDKFHPALVSTVQHLEIVVAMVLQLLVLHIFPSVYDVFGGVIIMISVFVLAGYKLYWRNVRREDYQEILDSPIK
Tissue specificity：
Induction：
Developmental stage：
Protein families：