S66A2_MOUSE   Q80XM9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80XM9

Recommended name:Solute carrier family 66 member 2

EC number:

Alternative names:(PQ-loop repeat-containing protein 1)

Cleaved into:

GeneID:66943

Gene names  (primary ):Slc66a2

Gene names  (synonym ):Pqlc1

Gene names  (ORF ):

Length:271

Mass:30580

Sequence:MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNIKRRSFAATDSKDEELRVPPRRPYLDFDPHHFWHWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNYCHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMVDLVILGQAYAFAHHPQKPAAHAVHPASTKAL

Tissue specificity:

Induction:

Developmental stage:

Protein families: