IN80B_MOUSE   Q99PT3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99PT3

Recommended name:INO80 complex subunit B

EC number:

Alternative names:(High mobility group AT-hook 1-like 4) (PAP-1-associated protein 1) (PAPA-1) (Zinc finger HIT domain-containing protein 4)

Cleaved into:

GeneID:70020

Gene names  (primary ):Ino80b

Gene names  (synonym ):Hmga1l4 Papa1 Znhit4

Gene names  (ORF ):

Length:375

Mass:40565

Sequence:MSACVPTVSSPLPLQDPMSKLWRRGSTSGAMEAPEPGETLELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEEAGPTLQTPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLPGDLEGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPTLPLPVGGGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAAPSGRGGRGAARGERRGGRAAAPAPAPMVRYCSGAQGSTLSFPPGVPTPTAVAQRPAPSGPAPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQLRLGGPEGPGSPLLAT

Tissue specificity:Expressed strongly in the testis and moderately in the kidney, skeletal muscle, liver and lung. {ECO:0000269|PubMed:15556297}.

Induction:

Developmental stage:

Protein families: