1433E_MOUSE P62259
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62259
Recommended name:14-3-3 protein epsilon
EC number:
Alternative names:(14-3-3E)
Cleaved into:
GeneID:22627
Gene names (primary ):Ywhae
Gene names (synonym ):
Gene names (ORF ):
Length:255
Mass:29174
Sequence:MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
Tissue specificity:
Induction:
Developmental stage:In the 8.5 dpc embryo, expressed throughout the embryo. Within a day, expression was more marked in mesenchyme than elsewhere (e.g. epithelial tissue, where it was generally low), although levels in neural tissue rose again by about 12.5 dpc. This difference was maintained until 15.5 dpc when expression levels started to drop in most tissues, with those of the nervous system, tooth, and kidney being exceptions. Strongly expressed in early mesenchyme. The expression decreased as the mesenchyme differentiated. {ECO:0000269|PubMed:7750640}.
Protein families:14-3-3 family