FA72A_MOUSE Q8BFZ8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BFZ8
Recommended name：Protein FAM72A
EC number：
Alternative names：
Cleaved into：
GeneID：108900
Gene names (primary )：Fam72a
Gene names (synonym )：
Gene names (ORF )：
Length：149
Mass：16626
Sequence：MSTNNCTFKDRCVSILCCKFCKQVLSSRGMKAVLLADTDIDLFSTDIPPTNTVDFIGRCYFTGICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYGINRLDATGVNLLLWGNLPETEECTDEETLEISAEEYIR
Tissue specificity：Expressed at high levels in stomach and also in kidney and, at low levels, in heart (at protein level). In the stomach, highly expressed in foveolar cells, parietal cells and chief cells (at protein level). In kidney, expressed in endothelial cells, mesangial and epithelial cells (parietal and visceral epithelium) around glomerulus (at protein level). {ECO:0000269|PubMed:21317926}.
Induction：
Developmental stage：
Protein families：FAM72 family