S2545_MOUSE Q8CFJ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CFJ7
Recommended name:Solute carrier family 25 member 45
EC number:
Alternative names:
Cleaved into:
GeneID:107375
Gene names (primary ):Slc25a45
Gene names (synonym ):
Gene names (ORF ):
Length:288
Mass:31690
Sequence:MPVEEFVAGWISGAVGLVLGHPFDTVKVRLQTQSTYQGIVDCVVKTYRHESVLGFFKGMSFPIASVALVNSVLFGVYSNTLLALTATSHQERRAQPPSYTNIFIAGCTGGLLQAYCLAPFDLIKVRLQNQTEPRMQISSSMPRYRGPVHCAASILREEGPQGLFRGSWALVLRDTPTLGMYFVTYEGLCRQYTPEGQNPSSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMASSFRQEGIGVFFKGMTLNSARAFPVNAATFLSYEYLLRLWR
Tissue specificity:Widely expressed, with highest levels in testis, liver and kidney and low levels in brain, including cortex, cerebellum, hippocampus and hypothalamus, and heart. {ECO:0000269|PubMed:19287344}.
Induction:
Developmental stage:
Protein families:Mitochondrial carrier (TC 2.A.29) family