PIMRE_MOUSE   Q8BFY7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BFY7

Recommended name:Protein PIMREG

EC number:

Alternative names:(CALM-interactor expressed in thymus and spleen homolog) (PICALM-interacting mitotic regulator) (Regulator of chromosome segregation protein 1)

Cleaved into:

GeneID:109212

Gene names  (primary ):Pimreg

Gene names  (synonym ):Cats Fam64a Rcs1

Gene names  (ORF ):

Length:231

Mass:25686

Sequence:MASQWQGMRTSVRRRSLLKEEQLEKKEVTRSAGGHPETGPLGSLCRQFQRRLPLRAVSLNLGNGPSWKRLESPEPEQQGLQAAARSAKSALGAMSQRIQESCQSGTKWLMETQVKVRRKRGAQKDRGSPPPSLSQKNTRLCRANRDARVGGHLRLSGQMGPHAHRRQRLRRESALRSPCSSTEPLCSPSESDSDLEPVGAGIQHLQKLSQRLDRAIKAEESGDMTVSLIRE

Tissue specificity:Mainly expressed in thymus and ovary. Expressed in all T-cell subpopulations isolated from the thymus, macrophages, pro-erythrocytes, granulocytes, mast cells and progenitor cells. {ECO:0000269|PubMed:19383357}.

Induction:

Developmental stage:Widely expressed at 9.5 dpc, including high levels in the neural tube, somites, the posterior region of the midbrain, olfactory placode and the branchial arches. At 10.5 dpc, reduction of the widespread expression and stronger expression in the neural tube, branchial arches, developing limbs, telencephalon, nasal process, lense vesicle, anterior and posterior regions of the mid- and hindbrain. From 11.5 dpc on, strongly expressed in the genital tubercle and hair and vibrissae follicles. From 12.5 dpc onwards, expression decreases, with a complete lack of expression in the cephalic region and the neural tube at 14.5 dpc. Strongly expressed during limb development, with higher levels in hindlimbs compared to forelimbs and expression slightly more marked in the posterior region of the limb buds. At 11.5 and 12.5 dpc, detected at the distal domain and the underlying mesenchyme, but not in the apical ectodermal ridge. Distally, becomes confined to the digits at 13.5 and 14.5 dpc. {ECO:0000269|PubMed:19383357}.

Protein families: