GT253_RAT Q5U309
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5U309
Recommended name：Probable inactive glycosyltransferase 25 family member 3
EC number：
Alternative names：
Cleaved into：
GeneID：RGD:1304778
Gene names (primary )：Cercam
Gene names (synonym )：Ceecam1, Glt25d3
Gene names (ORF )：
Length：572
Mass：65,223
Sequence：MLFIIRARACGGDARSWKQPDQLHPILFTNLRLPLQLIASSAGGATDHNVDNTTGMLQEWLAAVGRDYATVVWKSEDEARSYPDEQGPKHWTRERHQFLMELKQEALAFARDWGADYILFADTDNILTNNQTLRLLIDRQLPVVAPMLDSQTYYSNFWCGITPQGYYRRTAEYFPTKNRQRQGCFRVPMVHSTFLVSLQTEETARLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNDHRYGYMNVGVKPHQGLEEEKTNFIHLILEALVDGPPMMASAHVSRPPKKPSKMGFDEVFVISLARRPQRRARMLSSLWEMEISARVVDAVDGRTLNSSILKHLGVDLLPGYQDPYSGRTLTKGEVGCFLSHYSIWEEVVAKGLARVVVFEDDVRFEDNFRKRLERLMEDVLTQKLSWDLIYLGRKQVNPEEEVAVEGLPGLVVAGYSYWTLAYTLSLAGARKLLASQPLHRMLPVDEFLPVMFDRHPNDQYKAHFWPRDLQAFSARPLLASPTHYAGDTEWLSDTETSSPWDDDSGRLISWTGSQKTLRGPYLHLAGSSGHSLHPHPRDEL
Tissue specificity：
Induction：
Developmental stage：
Protein families：