AMGO1_MOUSE   Q80ZD8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80ZD8

Recommended name:Amphoterin-induced protein 1

EC number:

Alternative names:(AMIGO-1) (Alivin-2)

Cleaved into:

GeneID:229715

Gene names  (primary ):Amigo1

Gene names  (synonym ):Ali2 Amigo Kiaa1163

Gene names  (ORF ):

Length:492

Mass:55343

Sequence:MQPQRDLRGLWLLLLSVFLLLFEVARAGRSVVSCPANCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFNCSEYKESAWEAHLGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQGSNGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV

Tissue specificity:Expressed in hippocampal and cortical neurons (at protein level) (PubMed:22056818). High levels in cerebellum, cerebrum, and retina. Low levels in liver, kidney, small intestine, spleen, lung and heart. {ECO:0000269|PubMed:12629050, ECO:0000269|PubMed:22056818}.

Induction:

Developmental stage:

Protein families:Immunoglobulin superfamily, AMIGO family