AEBP2_MOUSE   Q9Z248


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z248

Recommended name:Zinc finger protein AEBP2

EC number:

Alternative names:(Adipocyte enhancer-binding protein 2) (AE-binding protein 2)

Cleaved into:

GeneID:11569

Gene names  (primary ):Aebp2

Gene names  (synonym ):

Gene names  (ORF ):

Length:504

Mass:52963

Sequence:MAAALADMADLEELSRLSPLSPGSPGPAARGRAEPPEEEEEEDDEEAEAEAVAALLLNGGAGGGAGGGEAETMSEPSPESASQAGGDEDEDEEDDEDEGSSSGGAEEESSAESLVGSSSGGCSGDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGGPGGPGSSGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTLMDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEESGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRFDILNFPR

Tissue specificity:Expressed in brain, brown adipose tissue, white adipose tissue, heart, kidney, lung, skeletal muscle, small intestine and spleen. Expressed at low levels in liver. {ECO:0000269|PubMed:10329662}.

Induction:

Developmental stage:

Protein families:AEBP2/jing C2H2-type zinc-finger family