TFF3_MOUSE Q62395
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62395
Recommended name：Trefoil factor 3
EC number：
Alternative names：(Intestinal trefoil factor) (mITF)
Cleaved into：
GeneID：21786
Gene names (primary )：Tff3
Gene names (synonym )：Itf
Gene names (ORF )：
Length：81
Mass：8808
Sequence：METRALWLMLLVVLVAGSSGIAADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF
Tissue specificity：Expressed in goblet cells of the intestines and colon (at protein level). Expressed abundantly in goblet cells of intestine and colon, and at low levels in stomach. No expression in brain, lung, spleen, kidney, uterus, pancreas, liver, heart or thymus. {ECO:0000269|PubMed:7575467, ECO:0000269|PubMed:7741746}.
Induction：
Developmental stage：No expression found in embryos. {ECO:0000269|PubMed:7741746}.
Protein families：