PI42C_MOUSE Q91XU3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91XU3
Recommended name:Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
EC number:EC 2.7.1.149
Alternative names:(Phosphatidylinositol 5-phosphate 4-kinase type II gamma) (PI(5)P 4-kinase type II gamma) (PIP4KII-gamma)
Cleaved into:
GeneID:117150
Gene names (primary ):Pip4k2c
Gene names (synonym ):Pip5k2c
Gene names (ORF ):
Length:421
Mass:47336
Sequence:MASSSVPPATAPAAAGGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHFFHRENLPSHFKFKEYCPQVFRNLRDRFAIDDHDYLVSLTRSPPSETEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVENEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKVFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEGPVREEESEWDGDCNLAGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFIANIFA
Tissue specificity:
Induction:
Developmental stage:No significant expression was discerned throughout the prenatal brains except for the olfactory mantle zone, which exhibited the expression signals weakly. On P0 and P7, the expression was weakly positive in the gray matter throughout the brain, with higher expression in the olfactory mitral cell layer. In the cerebellum, the expression was evenly positive in external and internal granule cell layers. On P21 and P56, the expression in non-cortical brain parenchyma was negligible. However, the expression was evident in the olfactory mitral cell layer, the piriform cortex, the hippocampal pyramidal CA1-3, and the cerebellar Purkinje cell layer, although much less distinct in the dentate granule cell layer and the cerebellar granule cell layer. In the cerebral cortex, the expression was weaker in layer V than the other layers. No significant expression was seen in the white matter. {ECO:0000269|PubMed:15018809}.
Protein families: