SSTY1_MOUSE   P13675


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P13675

Recommended name:Y-linked testis-specific protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:20611

Gene names  (primary ):Ssty1

Gene names  (synonym ):Smy

Gene names  (ORF ):

Length:232

Mass:26796

Sequence:MSSLMKKRRRKSSSNTLRNIVSCRISHSWKEGNEPVTQWKAIVLDQLPTNPSLYFVKYDGIDSIYVLELYSDDRILNLKVLPPIVVFPQVRDAHLARALVGRAVQHKFERKDGSEVNWRGVVLAQVPIMKDLFYITYKKDPALYAYQLLDDYKEGNLHMIPDTPPAEERSGDDSDVLIGNWVEYTRKDGSKKFGKVVYQVLANPSVYFIKFHGDIHIYVYTMVPKILEVEKS

Tissue specificity:Expressed in testis (at protein level). {ECO:0000269|PubMed:14667817}.

Induction:

Developmental stage:Not detectable at 20 days postpartum (dpp), barely detectable at 22 days postpartum and is strongly detected thereafter (at protein level). Expression is restricted to spermatid stages. {ECO:0000269|PubMed:14667817}.

Protein families:SPIN/STSY family


   💬 WhatsApp