PR3D1_MOUSE P18121
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P18121
Recommended name：Prolactin-3D1
EC number：
Alternative names：(Chorionic somatomammotropin hormone 1) (Placental lactogen I) (PL-I)
Cleaved into：
GeneID：
Gene names (primary )：Prl3d1
Gene names (synonym )：Csh1 Pl-1 Pl1
Gene names (ORF )：
Length：224
Mass：25524
Sequence：MQLTLNLSGSAGMQLLLLVSSLLLWENVSSKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC
Tissue specificity：
Induction：
Developmental stage：Placental lactogen I is expressed in mid-pregnancy, while placental lactogen II is expressed throughout the later half of pregnancy.
Protein families：Somatotropin/prolactin family