SNAI1_MOUSE   Q02085


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q02085

Recommended name:Zinc finger protein SNAI1

EC number:

Alternative names:(Protein snail homolog 1) (Protein sna)

Cleaved into:

GeneID:20613

Gene names  (primary ):Snai1

Gene names  (synonym ):Sna

Gene names  (ORF ):

Length:264

Mass:29190

Sequence:MPRSFLVRKPSDPRRKPNYSELQDACVEFTFQQPYDQAHLLAAIPPPEVLNPAASLPTLIWDSLLVPQVRPVAWATLPLRESPKAVELTSLSDEDSGKSSQPPSPPSPAPSSFSSTSASSLEAEAFIAFPGLGQLPKQLARLSVAKDPQSRKIFNCKYCNKEYLSLGALKMHIRSHTLPCVCTTCGKAFSRPWLLQGHVRTHTGEKPFSCSHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHKHQESGCSGGPR

Tissue specificity:While expression is completely absent from non-invasive cell lines, it is high in invasive and metastatic cell types.

Induction:

Developmental stage:Postimplantation. Expression is observed in undifferentiated mesoderm and in tissues undergoing EMTs, namely the precursors of the neural crest cells and the primitive streak. {ECO:0000269|PubMed:10655586}.

Protein families:Snail C2H2-type zinc-finger protein family


   💬 WhatsApp