DRG1_MOUSE P32233
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P32233
Recommended name：Developmentally-regulated GTP-binding protein 1
EC number：EC 3.6.5.-
Alternative names：(DRG-1) (Neural precursor cell expressed developmentally down-regulated protein 3) (NEDD-3) (Translation factor GTPase DRG1) (TRAFAC GTPase DRG1) (EC 3.6.5.-)
Cleaved into：
GeneID：13494
Gene names (primary )：Drg1
Gene names (synonym )：Drg Nedd-3 Nedd3
Gene names (ORF )：
Length：367
Mass：40512
Sequence：MSGTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK
Tissue specificity：Fairly high levels in liver, heart, kidney, testis and brain. Very low levels in lung, spleen, and skeletal muscle. {ECO:0000269|PubMed:1280421}.
Induction：
Developmental stage：Predominantly expressed in the embryo and down-regulated during development. {ECO:0000269|PubMed:1280421}.
Protein families：TRAFAC class OBG-HflX-like GTPase superfamily, OBG GTPase family