CEAMA_MOUSE Q61400
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61400
Recommended name：Carcinoembryonic antigen-related cell adhesion molecule 10
EC number：
Alternative names：(CEA-related cell adhesion molecule 10) (CEA10) (Carcinoembryonic antigen 10)
Cleaved into：
GeneID：26366
Gene names (primary )：Ceacam10
Gene names (synonym )：Cea10
Gene names (ORF )：
Length：265
Mass：29474
Sequence：MELASAHLHKGQVPWVGLLLTASLLTYWSPATTAQVTVEAVPPNVTADNNVLLLVHNLPQTLRVFYWYKGNSGAGHNEIGRFVTSINRSKMGLAHSGRETIYSNGSLFFQSVTKNDEGVYTLYMLDQNFEITPISVRFHVHPSLLPSLSPPTTGQVTVEAVPPNVAEGENVLLLVHNLPRTLRAIYWYRGTTAGERNEIARFITASNKIILGPAHSDREIIYNNGSLFFQGVTKNDEGAYALDMLFQNFDHTLMPVQFNVHAKKQ
Tissue specificity：Abundant in seminal vesicle and traces in epididymis and prostate (at protein level). Highly expressed in seminal vesicle, minor in colon and placenta and, to a lesser extent, in small intestine, caecum, stomach, salivary gland and bone marrow. {ECO:0000269|PubMed:15901639}.
Induction：
Developmental stage：Present in trace amounts on 5.5 dpc, increased remarkably from 6.5 dpc to a maximum on 9.5 dpc and rapidly declined thereafter to an almost undetectable level until delivery. First appeared at a considerable level in 3-week-old mice. Thereafter, the amount of transcript began increasing rapidly at 4-week-old mice and reached a maximum in 7-week-old mice. {ECO:0000269|PubMed:15901639}.
Protein families：Immunoglobulin superfamily, CEA family