NKAPL_MOUSE Q5SZT7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5SZT7
Recommended name：NKAP-like protein
EC number：
Alternative names：
Cleaved into：
GeneID：66707
Gene names (primary )：Nkapl
Gene names (synonym )：
Gene names (ORF )：
Length：395
Mass：44894
Sequence：MSPVSRSRPNEDTLGSQKRRRFSESPPSALQTSRSPRGGGFGSLLSGPEGLQPPRGAQGVRPLHPISRPRSGERPLPLGIRTLACSSSPICGGYRYHHNYAGDPSWAEDQEKEKEESYRQRRLKERERIGELGAPEVWGLSPKIPEPDSDEHTPAEDEVKNQKSSSSDFTNEEKRTKTSHSTKKKRKKKPSKRKHKKYYDSSSDCHSSSDSDKKKVKTKKKEKKKKHRAKQLKKKRTKKEYNDISCKASERDLPEDAWMEQSMSAESMDLIGPEAPVIHTSQDEKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDDK
Tissue specificity：Specific to testis (at protein level). Detected in differenting spermatogonia and early spermatocytes (at protein level). {ECO:0000269|PubMed:25875095}.
Induction：
Developmental stage：Strongly expressed in testis from 3 weeks onwards. {ECO:0000269|PubMed:25875095}.
Protein families：NKAP family