LEG9_MOUSE   O08573


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O08573

Recommended name:Galectin-9

EC number:

Alternative names:(Gal-9)

Cleaved into:

GeneID:16859

Gene names  (primary ):Lgals9

Gene names  (synonym ):

Gene names  (ORF ):

Length:353

Mass:40036

Sequence:MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQNSAAPVQHVFSTLQFSQPVQFPRTPKGRKQKTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT

Tissue specificity:Accentuated expression in liver and thymus of embryo, detected in embryonic heart, brain, lung, liver, and kidney. Highly expressed in adult thymus, small intestine, and liver, and to a lesser extent in lung, kidney, spleen, cardiac, and skeletal muscle. Barely detectable in brain and reticulocyte. Expressed in placenta, uterus and decidua during pregnancy (PubMed:23242525). Expressed in CD4+ T-cells with higher levels in iTreg cells than other T-cell types and sustained high levels throughout iTreg cell differentiation (at protein level) (PubMed:25065622). Expressed in myeloid cells in lung (PubMed:20937702). Constitutively expressed in microglia (PubMed:25158758). Isoform 1 is expressed exclusively in the small intestine. Isoform 2 expression in decidua increases in pathological pregnancy from gestation day 7.5 to 13.5 and it is higher than in normal pregnancy (PubMed:23242525). Isoform 3 expression in decidua is higher in normal pregnancy than in pathological pregnancy (PubMed:23242525). {ECO:0000269|PubMed:20937702, ECO:0000269|PubMed:23242525, ECO:0000269|PubMed:25065622, ECO:0000269|PubMed:25158758}.

Induction:By viral mimic polyinosinic:polycytidylic acid (poly I:C) and lipopolysaccharides (LPS) in microglia (PubMed:25158758). Up-regulated in macrophages following infection with Mycobacterium tuberculosis (PubMed:20937702). {ECO:0000269|PubMed:20937702, ECO:0000269|PubMed:25158758}.

Developmental stage:The expression increases with successive stages of embryonic development.

Protein families:


   💬 WhatsApp