UCMA_MOUSE Q14BU0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14BU0
Recommended name：Unique cartilage matrix-associated protein
EC number：
Alternative names：(Upper zone of growth plate and cartilage matrix associated protein)
Cleaved into：Unique cartilage matrix-associated protein C-terminal fragment (Ucma-C) (Gla-rich protein) (GRP)
GeneID：68527
Gene names (primary )：Ucma
Gene names (synonym )：
Gene names (ORF )：
Length：138
Mass：16579
Sequence：MSWRRVILLSSLLALVLLCMLQEGTSASVGSRQAAAEGVQEGVKQKIFMQESDASNFLKRRGKRSPKSRDEVNAENRQRLRDDELRREYYEEQRNEFENFVEEQRDEQEERTREAVEQWRQWHYDGLYPSYLYNRQNI
Tissue specificity：Predominantly expressed in resting chondrocytes. {ECO:0000269|PubMed:18156182}.
Induction：Expression inhibited by TGFB1, and weakly inhibited by BMP2. {ECO:0000269|PubMed:19819238}.
Developmental stage：Transiently expressed in the developing mouse skeleton between day 13.5 dpc of embryonic development and 5 months of postnatal development. Absent in undifferentiated mesenchymal cells. Isoforms 1 and 3 are significantly increased with the onset of chondrogenesis, whereas Isoforms 2 and 4 are detected at a later stage. {ECO:0000269|PubMed:18156182, ECO:0000269|PubMed:19819238}.
Protein families：UCMA family