PA2GD_MOUSE Q9WVF6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WVF6
Recommended name：Group IID secretory phospholipase A2
EC number：EC 3.1.1.4
Alternative names：(GIID sPLA2) (sPLA2-IID) (PLA2IID) (Phosphatidylcholine 2-acylhydrolase 2D) (Secretory-type PLA, stroma-associated homolog)
Cleaved into：
GeneID：18782
Gene names (primary )：Pla2g2d
Gene names (synonym )：Pla2a2 Splash
Gene names (ORF )：
Length：144
Mass：16164
Sequence：MRLALLCGLLLAGITATQGGLLNLNKMVTHMTGKKAFFSYWPYGCHCGLGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNKRLRYYWRPRCKGKTPAC
Tissue specificity：Highly expressed in secondary lymphoid tissues, spleen and lymph nodes. Expressed at a lesser extent in thymus (PubMed:11196711, PubMed:10455175, PubMed:10531313, PubMed:23690440). Expressed in CD4-positive, IL2RA/CD25-positive, FOXP3-positive Tregs (at protein level) (PubMed:19564598, PubMed:23690440). Expressed in myeloid cell subsets resident in spleen and lymph nodes, ITGAX/CD11C-positive dendritic cells and macrophages (at protein level). Enriched in CD4-positive, ITGAM/CD11B-positive dendritic cell subset (PubMed:19564598, PubMed:23690440). Expressed in pulmonary ITGAX/CD11C-positive dendritic cell subset (at protein level) (PubMed:26392224). {ECO:0000269|PubMed:10455175, ECO:0000269|PubMed:10531313, ECO:0000269|PubMed:11196711, ECO:0000269|PubMed:19564598, ECO:0000269|PubMed:23690440, ECO:0000269|PubMed:26392224}.
Induction：Up-regulated in thymus upon endotoxin challenge (PubMed:10455175). Up-regulated during Treg differention in response to TGFB1 (PubMed:19564598). Up-regulated in pulmonary ITGAX/CD11C-positive dendritic cell subset upon chronic oxidative stress associated with aging (PubMed:26392224). {ECO:0000269|PubMed:10455175, ECO:0000269|PubMed:19564598, ECO:0000269|PubMed:26392224}.
Developmental stage：Undetectable in embryonic spleens. Weak expression is detected the first week after birth, with further increase to normal levels by 4-6 weeks after birth. {ECO:0000269|PubMed:11196711}.
Protein families：Phospholipase A2 family