DAPL1_MOUSE Q9D757
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D757
Recommended name:Death-associated protein-like 1
EC number:
Alternative names:(Early epithelial differentiation-associated protein)
Cleaved into:
GeneID:76747
Gene names (primary ):Dapl1
Gene names (synonym ):Eeda
Gene names (ORF ):
Length:107
Mass:11813
Sequence:MANEVQVLPSPLKGRYAPAVKAGGMRISKKQEMGVLERHTKKTGLEKTSAITNVAKIQMLDALTDTLDKLNHKFPATVHTAHQKPTPALEKAAPMKRAYIIQQPRKC
Tissue specificity:Expressed in hair follicle, corneal epithelium, epidermis and footpad epithelium (at protein level). {ECO:0000269|PubMed:15920738}.
Induction:
Developmental stage:Weakly expressed in outer cells of the two cell-layer ectoderm at embryonic day 14.5. Detected only in the intermediate cells, undetectable in the basal or outermost epidermal cells or the occasional follicular buds. In 17.5 dpc and 18.5 dpc epidermis expression is restricted to a single layer of suprabasal cells and is absent in the granular cell layer. Also present in the differentiated follicular cells at the apex of the 'horseshoeshaped' matrix. Detected throughout the limbal and corneal epithelium at day 1 of postnatal life, at day 5 of post-natal life it was no longer detected in the limbal epithelium. {ECO:0000269|PubMed:15920738}.
Protein families: